(data stored in ACNUC10043 zone)

EMBL: AP011532.PE25

AP011532.PE25        Location/Qualifiers
FT   CDS             17105..18079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60097"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH5"
FT                   /protein_id="BAI60097.1"
FT                   /translation="MQATLDWLAGLARQHPEVFGGHPGEMAVLEASRSSSHESRVYGSG
FT                   GALVHVKFFRRTLGRTSVTYDPCREMKAEYDTLREFEKNGFASGRHRVVRTLGINESLD
FT                   CALATAYVPGDTLLSIIQRTLKGGDDGELLEALGLAAGFLRKVHGLMPQSPKVDAAETF
FT                   YSYMKPLFYLEEQGALDGFHRRVTKGLSRWYGHRPLFEQRGVTVHGDANPSNFKIHEGV
FT                   IYGLDLERSRPGRSPLLDVGTMVAELEHHCAYVAGDAGRAKPYVERFLRAYAPSPADRK
FT                   KIDELLPFYVSRGLLKIAMLGYWKHGYRRSLVEAGARRIEEGP"
     MQATLDWLAG LARQHPEVFG GHPGEMAVLE ASRSSSHESR VYGSGGALVH VKFFRRTLGR        60
     TSVTYDPCRE MKAEYDTLRE FEKNGFASGR HRVVRTLGIN ESLDCALATA YVPGDTLLSI       120
     IQRTLKGGDD GELLEALGLA AGFLRKVHGL MPQSPKVDAA ETFYSYMKPL FYLEEQGALD       180
     GFHRRVTKGL SRWYGHRPLF EQRGVTVHGD ANPSNFKIHE GVIYGLDLER SRPGRSPLLD       240
     VGTMVAELEH HCAYVAGDAG RAKPYVERFL RAYAPSPADR KKIDELLPFY VSRGLLKIAM       300
     LGYWKHGYRR SLVEAGARRI EEGP                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page