(data stored in ACNUC10043 zone)

EMBL: AP011532.PE254

AP011532.PE254       Location/Qualifiers
FT   CDS             complement(257438..260098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Pyruvate phosphate dikinase,
FT                   PEP/pyruvate-binding domain (IPR002192). ; Contains one
FT                   PEP-utilising enzyme, mobile region domain (IPR008279)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60326"
FT                   /db_xref="GOA:D1YV54"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV54"
FT                   /protein_id="BAI60326.1"
FT                   /translation="MERYVLYFSEIDKASLPEVGGKGSSLGEMTKAGYPVPGGFCITTA
FT                   AYRKFIRSCEEMDELIDLLEGIRHDDLGRIHELGESVRKCLRSHQMPDDIRESILEAWK
FT                   LTGEDKAYAVRSSATAEDLPTASFAGQQETYLNVRDGERMLHAIRDCWASLFTDRAISY
FT                   RARSGFGHGRVYISVVVQEMVFPEVSGILFTADPITGRRRTASIDASFGLGEALVSGVV
FT                   TADHYKVRSGVIVEKRIAKKAVAISPLPEGGTVKKDIPPERQEAQALSDEKIVELARLG
FT                   EGIEAHYGTEQDIEWCLADGKLYVLQSRPITTLFPVPRIAGDGLHVLISFGHVQMMMDP
FT                   IRPLGISVLKSFLKFAKPSPESDIVVEAGGRLFIDPTPLLVLRPAQHLAPRILAVMFDE
FT                   RMAASLREVFGRSDFRRAKRIKIGTLIKAALAVLPGIGKAILIVLFADPARGRDYLVAS
FT                   TGQLWIAREREISSVSGPVRIRLIQDGLEKLLPTLFPMVFPYLIAAIPSSRIIHGMLKS
FT                   QYGEKQGAHMFSRLNRSLPGNVTTDSGLAVGDLADVARKYPEVVDYLRRAKDETFYAGL
FT                   LEVDGGAEFKRALDRFMDQYGVRSPGEIDITNPRWKDSPALLVPPILSHIRSVGPGEHR
FT                   ERFERGEEDANLAAAEILSDMGKARLGFFKAKAMSRLIHVYRNLMGMREYPKYLIMQQF
FT                   YVFRQGILGEARSLVEAGILAREKDVFYLSLDELLALEEGHFSGNVGEIVALREKQREQ
FT                   FQKLTPPRVMTSEGEAITGKRQATGEPEGAIIGTPASAGVVEGIARIVLKPEDAKLSPG
FT                   EILVAPYTDPGWTPLFNSAKGLVTEVGGMMTHGSVIAREYGIPAVVGAENATSLIKDGA
FT                   RIRVNGNEGFVQILD"
     MERYVLYFSE IDKASLPEVG GKGSSLGEMT KAGYPVPGGF CITTAAYRKF IRSCEEMDEL        60
     IDLLEGIRHD DLGRIHELGE SVRKCLRSHQ MPDDIRESIL EAWKLTGEDK AYAVRSSATA       120
     EDLPTASFAG QQETYLNVRD GERMLHAIRD CWASLFTDRA ISYRARSGFG HGRVYISVVV       180
     QEMVFPEVSG ILFTADPITG RRRTASIDAS FGLGEALVSG VVTADHYKVR SGVIVEKRIA       240
     KKAVAISPLP EGGTVKKDIP PERQEAQALS DEKIVELARL GEGIEAHYGT EQDIEWCLAD       300
     GKLYVLQSRP ITTLFPVPRI AGDGLHVLIS FGHVQMMMDP IRPLGISVLK SFLKFAKPSP       360
     ESDIVVEAGG RLFIDPTPLL VLRPAQHLAP RILAVMFDER MAASLREVFG RSDFRRAKRI       420
     KIGTLIKAAL AVLPGIGKAI LIVLFADPAR GRDYLVASTG QLWIAREREI SSVSGPVRIR       480
     LIQDGLEKLL PTLFPMVFPY LIAAIPSSRI IHGMLKSQYG EKQGAHMFSR LNRSLPGNVT       540
     TDSGLAVGDL ADVARKYPEV VDYLRRAKDE TFYAGLLEVD GGAEFKRALD RFMDQYGVRS       600
     PGEIDITNPR WKDSPALLVP PILSHIRSVG PGEHRERFER GEEDANLAAA EILSDMGKAR       660
     LGFFKAKAMS RLIHVYRNLM GMREYPKYLI MQQFYVFRQG ILGEARSLVE AGILAREKDV       720
     FYLSLDELLA LEEGHFSGNV GEIVALREKQ REQFQKLTPP RVMTSEGEAI TGKRQATGEP       780
     EGAIIGTPAS AGVVEGIARI VLKPEDAKLS PGEILVAPYT DPGWTPLFNS AKGLVTEVGG       840
     MMTHGSVIAR EYGIPAVVGA ENATSLIKDG ARIRVNGNEG FVQILD                      886
//

If you have problems or comments...

PBIL Back to PBIL home page