(data stored in ACNUC10043 zone)

EMBL: AP011532.PE256

AP011532.PE256       Location/Qualifiers
FT   CDS             complement(261696..262433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0256"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60328"
FT                   /db_xref="GOA:D1YV56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV56"
FT                   /protein_id="BAI60328.1"
FT                   /translation="MEKRTEEYIIDCSALSMRFGKITALDNVDLKIPYGENYGLLGPNG
FT                   AGKTTLIRILCGLLKPTGGSASVMGRRQPDRRNNLSIGYMTQMDALYSDLTIRENVRFF
FT                   ASLYGQQGHEREKCIDDILDITRLSDRQNSIVSTISGGMRKRASMACVLVHRPKLLFLD
FT                   EPTVGVDPQLRCELWKYFHYLNNEGVTLIVSTHVMDEAEHCNRLAFIRDGRKLIEGSPA
FT                   ELKEYTSCDNLEAAFMKFSEGGQ"
     MEKRTEEYII DCSALSMRFG KITALDNVDL KIPYGENYGL LGPNGAGKTT LIRILCGLLK        60
     PTGGSASVMG RRQPDRRNNL SIGYMTQMDA LYSDLTIREN VRFFASLYGQ QGHEREKCID       120
     DILDITRLSD RQNSIVSTIS GGMRKRASMA CVLVHRPKLL FLDEPTVGVD PQLRCELWKY       180
     FHYLNNEGVT LIVSTHVMDE AEHCNRLAFI RDGRKLIEGS PAELKEYTSC DNLEAAFMKF       240
     SEGGQ                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page