(data stored in ACNUC10043 zone)

EMBL: AP011532.PE261

AP011532.PE261       Location/Qualifiers
FT   CDS             266120..266734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0261"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60333"
FT                   /db_xref="GOA:D1YV61"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV61"
FT                   /protein_id="BAI60333.1"
FT                   /translation="MGVLGDNGQISTVEAITAAIIMISVIVLVVQATSVTPLTSSFTNQ
FT                   HIKLELQNIGMDVLTTLDETPSVNDGNHDTQSMLKKSVTDWINNYYCDWFTWANNADKY
FT                   KSQTNPLNPSLNIPLGDQLSYLLAYYGIAYNVEIRYSDINNNVKITKMIWNGNPSDNSV
FT                   TVSRFVVLHDEDILYRDLIPNFGLTTDFYNIVEVKVTLWVM"
     MGVLGDNGQI STVEAITAAI IMISVIVLVV QATSVTPLTS SFTNQHIKLE LQNIGMDVLT        60
     TLDETPSVND GNHDTQSMLK KSVTDWINNY YCDWFTWANN ADKYKSQTNP LNPSLNIPLG       120
     DQLSYLLAYY GIAYNVEIRY SDINNNVKIT KMIWNGNPSD NSVTVSRFVV LHDEDILYRD       180
     LIPNFGLTTD FYNIVEVKVT LWVM                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page