(data stored in ACNUC10043 zone)

EMBL: AP011532.PE269

AP011532.PE269       Location/Qualifiers
FT   CDS             273712..274770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0269"
FT                   /product="sodium/calcium exchanger protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0269"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60341"
FT                   /db_xref="GOA:D1YV69"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV69"
FT                   /protein_id="BAI60341.1"
FT                   /translation="MDLIVFLLSFAIILIACEFFTNGVEWTGRRFNLSEGAVGSVLAAV
FT                   GTALPETLVPLIAILMIGGDAGHEIGVGAILGAPFMLATLALFICGLSVLIFAKRRNTR
FT                   TLHINGKLIRRDLKFFLLAYALAAVAAFTPPEFGIFKTILGFTLIPLYIVYTIYTLKTG
FT                   EAATGGDDMKALYLDSVIKRCIPGKADKDCPAPREPSTALIIVQVLAALGAIILGANLF
FT                   VNQINAIAMFIGINPLILSLVISPIATELPEKFNSMLWIRERKDTYAIGNITGAMVFQS
FT                   CIPVTIGIFLTSWHLNIANPVELLEAMTIGIALLSGIILYIESSHKELKMSGLMIGGLL
FT                   YVLFFVAVLLSI"
     MDLIVFLLSF AIILIACEFF TNGVEWTGRR FNLSEGAVGS VLAAVGTALP ETLVPLIAIL        60
     MIGGDAGHEI GVGAILGAPF MLATLALFIC GLSVLIFAKR RNTRTLHING KLIRRDLKFF       120
     LLAYALAAVA AFTPPEFGIF KTILGFTLIP LYIVYTIYTL KTGEAATGGD DMKALYLDSV       180
     IKRCIPGKAD KDCPAPREPS TALIIVQVLA ALGAIILGAN LFVNQINAIA MFIGINPLIL       240
     SLVISPIATE LPEKFNSMLW IRERKDTYAI GNITGAMVFQ SCIPVTIGIF LTSWHLNIAN       300
     PVELLEAMTI GIALLSGIIL YIESSHKELK MSGLMIGGLL YVLFFVAVLL SI               352
//

If you have problems or comments...

PBIL Back to PBIL home page