(data stored in ACNUC10043 zone)

EMBL: AP011532.PE27

AP011532.PE27        Location/Qualifiers
FT   CDS             18921..20243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Cobalamin vitamin B12-binding domain
FT                   (IPR006158).; Contains one Elongator protein 3/MiaB/NifB
FT                   domain (IPR006638).; Contains one Radical SAM domain
FT                   (IPR007197)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60099"
FT                   /db_xref="GOA:D1YUH7"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH7"
FT                   /protein_id="BAI60099.1"
FT                   /translation="MKVLLVYTNRYRPMAPPPVGIAYLAGPLLREGHEVRVLDLMFSSD
FT                   PEGELWRALDEFRPDVAGLSIRNVDNQDMRHTQYFIDDAKKLAGIVHKAGVKTVLGGTA
FT                   FTTFPAETLQYLGGDYGIAGQGEESLPRLLASLASGRLDRGIPGLVWREGGRIMANPPD
FT                   LGGYRSAARWDLLHLNGYTKGFLAGSAVTKSGCPYRCAYCNVTTAFGGELRPRNVGDVV
FT                   EEIKALKAQGIRIVTLTDACFNVPSGYAKEVLNAIIDSGVRVYLNTTFVPVAGHFDDEL
FT                   MELFKRAGGIYASLGAETFSRKMLKSYHKPFTLDDVLACAGLLGRHHIPFMVQALFGGP
FT                   GEDASTLRESLDMLRHVPYAEFTYTMGIRLLPGTLLFETAKKEGLAGDASGLFRPRFYI
FT                   SKDLDVPWAERQIRRTMLRYSYRGLKMLPVAARCALAGVNW"
     MKVLLVYTNR YRPMAPPPVG IAYLAGPLLR EGHEVRVLDL MFSSDPEGEL WRALDEFRPD        60
     VAGLSIRNVD NQDMRHTQYF IDDAKKLAGI VHKAGVKTVL GGTAFTTFPA ETLQYLGGDY       120
     GIAGQGEESL PRLLASLASG RLDRGIPGLV WREGGRIMAN PPDLGGYRSA ARWDLLHLNG       180
     YTKGFLAGSA VTKSGCPYRC AYCNVTTAFG GELRPRNVGD VVEEIKALKA QGIRIVTLTD       240
     ACFNVPSGYA KEVLNAIIDS GVRVYLNTTF VPVAGHFDDE LMELFKRAGG IYASLGAETF       300
     SRKMLKSYHK PFTLDDVLAC AGLLGRHHIP FMVQALFGGP GEDASTLRES LDMLRHVPYA       360
     EFTYTMGIRL LPGTLLFETA KKEGLAGDAS GLFRPRFYIS KDLDVPWAER QIRRTMLRYS       420
     YRGLKMLPVA ARCALAGVNW                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page