(data stored in ACNUC10043 zone)

EMBL: AP011532.PE274

AP011532.PE274       Location/Qualifiers
FT   CDS             279459..280481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domains (IPR001450)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60346"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV74"
FT                   /protein_id="BAI60346.1"
FT                   /translation="MTVHFVPWDTSHNLLSRAEKLYEAAGTLDCVAEGDLVAVKLHVGE
FT                   LGNPYYVQPFFVHQLVQKIREAGGKPFLTDSNTYYLAQRNNAVDHYETSLANGFGFCQF
FT                   IAADGLRSESGRLVSTKGILKGIEVSGAIAEADAMIVVSHDKGHALTGFGGAVKNMGMG
FT                   CTTRAGKLRQHRTVGLKIDESKCSGCGLCRKVCEMGLPEIVDKKAKNVSRECMRCPVCM
FT                   EACPKGAIKLLKKENLGRALASAAYGVLSTFGKNKTSFVSFADNITQYCDCVPAPGHVV
FT                   MNDIGIFASSSPVSVDAAFLQKADHKYFNEAYDVDCWTQVKELKELGIQGELKPKIKEA
FT                   "
     MTVHFVPWDT SHNLLSRAEK LYEAAGTLDC VAEGDLVAVK LHVGELGNPY YVQPFFVHQL        60
     VQKIREAGGK PFLTDSNTYY LAQRNNAVDH YETSLANGFG FCQFIAADGL RSESGRLVST       120
     KGILKGIEVS GAIAEADAMI VVSHDKGHAL TGFGGAVKNM GMGCTTRAGK LRQHRTVGLK       180
     IDESKCSGCG LCRKVCEMGL PEIVDKKAKN VSRECMRCPV CMEACPKGAI KLLKKENLGR       240
     ALASAAYGVL STFGKNKTSF VSFADNITQY CDCVPAPGHV VMNDIGIFAS SSPVSVDAAF       300
     LQKADHKYFN EAYDVDCWTQ VKELKELGIQ GELKPKIKEA                             340
//

If you have problems or comments...

PBIL Back to PBIL home page