(data stored in ACNUC10043 zone)

EMBL: AP011532.PE276

AP011532.PE276       Location/Qualifiers
FT   CDS             complement(281529..281903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Ferritin-like domain (IPR009040).;
FT                   Contains one Rubrerythrin domain (IPR003251)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60348"
FT                   /db_xref="GOA:D1YV76"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV76"
FT                   /protein_id="BAI60348.1"
FT                   /translation="MSKLTKIMEQTFTGETYEVGLYLAMAKKAELDNMPEVATYLRGLA
FT                   MEEAGHACEVAIMLDKIKGTKENLEYMLGGETMATREKMDAARIAKEEGNNDAATFFER
FT                   ASADENRHRSGLQGFLNKMK"
     MSKLTKIMEQ TFTGETYEVG LYLAMAKKAE LDNMPEVATY LRGLAMEEAG HACEVAIMLD        60
     KIKGTKENLE YMLGGETMAT REKMDAARIA KEEGNNDAAT FFERASADEN RHRSGLQGFL       120
     NKMK                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page