(data stored in ACNUC10043 zone)

EMBL: AP011532.PE278

AP011532.PE278       Location/Qualifiers
FT   CDS             complement(282630..282809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF343
FT                   family (IPR005651)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60350"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV78"
FT                   /protein_id="BAI60350.1"
FT                   /translation="MKKDLMDILCCPVCKGDLELTVKKESGPEVIEGTLHCKKCNENYP
FT                   IEDGIPNLLPPELR"
     MKKDLMDILC CPVCKGDLEL TVKKESGPEV IEGTLHCKKC NENYPIEDGI PNLLPPELR         59
//

If you have problems or comments...

PBIL Back to PBIL home page