(data stored in ACNUC10043 zone)

EMBL: AP011532.PE28

AP011532.PE28        Location/Qualifiers
FT   CDS             20290..20700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0028"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60100"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH8"
FT                   /protein_id="BAI60100.1"
FT                   /translation="MIERLTHVTVLVRDSDEALKFYTEKLGFEKVEDSKMPTGDRWLTV
FT                   RPKGGDVQIVLQQPGAATFGEEGAKEMLRRVGQGTTWAFKVDDCQGTCDELVKKGVKIL
FT                   SSPQDFGFAVEAIFADLYGNAYILMQPPAGPK"
     MIERLTHVTV LVRDSDEALK FYTEKLGFEK VEDSKMPTGD RWLTVRPKGG DVQIVLQQPG        60
     AATFGEEGAK EMLRRVGQGT TWAFKVDDCQ GTCDELVKKG VKILSSPQDF GFAVEAIFAD       120
     LYGNAYILMQ PPAGPK                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page