(data stored in ACNUC10043 zone)

EMBL: AP011532.PE296

AP011532.PE296       Location/Qualifiers
FT   CDS             complement(300556..301401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two CBS domains (IPR000644)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60368"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV96"
FT                   /protein_id="BAI60368.1"
FT                   /translation="MTEVSEIMTAPVYAVSPRDNVARARNLMLRYGVSRLVVAEGNTLR
FT                   GIVTRKDIGSRLSQAEPQWRRRPIDQIPVDLVATHDVFTVKPDAQIQDVASTMLCHDIS
FT                   GLVVYDSEIRGIVTKHDMVKYFTLLGSPLRVGDMMSEKVVTVSRHHTINSVIDIMAENG
FT                   VDRVIVRDGGPAAAYAGMVTLDDLGFATMDFRDTKPIKEAHRMVQGGPKMLRGFREAMM
FT                   VAEDVMSTPLVSVNRGTKALDAAKLMLEHNYDMLPVIDSELLGEFSVESILKWLSEARE
FT                   "
     MTEVSEIMTA PVYAVSPRDN VARARNLMLR YGVSRLVVAE GNTLRGIVTR KDIGSRLSQA        60
     EPQWRRRPID QIPVDLVATH DVFTVKPDAQ IQDVASTMLC HDISGLVVYD SEIRGIVTKH       120
     DMVKYFTLLG SPLRVGDMMS EKVVTVSRHH TINSVIDIMA ENGVDRVIVR DGGPAAAYAG       180
     MVTLDDLGFA TMDFRDTKPI KEAHRMVQGG PKMLRGFREA MMVAEDVMST PLVSVNRGTK       240
     ALDAAKLMLE HNYDMLPVID SELLGEFSVE SILKWLSEAR E                           281
//

If you have problems or comments...

PBIL Back to PBIL home page