(data stored in ACNUC10043 zone)

EMBL: AP011532.PE298

AP011532.PE298       Location/Qualifiers
FT   CDS             complement(302372..303157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two CBS domains (IPR000644)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60370"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV98"
FT                   /protein_id="BAI60370.1"
FT                   /translation="MRVSDIMATNPQSVAPGEFVTHAREIMREYNYDSLPVVDNGRVAG
FT                   MITLQDIINVTSTRSDVTVSGYVRADVPRLTPDTGLPRAAFIVIRTDEGRVPVVDPDSR
FT                   LVGLLSVKDIFKGLPELELEDRPVSEYMTRKVVVCQPEDSLSRVWLNMIHYGLTGFPVV
FT                   GDRMEVIGMVTREDITKRGYARIERESEGKKNPTTVQKIMSTPAITVEENDSIRKAAKI
FT                   FMERNIGRVPVVMNGKLTGIVDRYDVIRACRALQGVTPR"
     MRVSDIMATN PQSVAPGEFV THAREIMREY NYDSLPVVDN GRVAGMITLQ DIINVTSTRS        60
     DVTVSGYVRA DVPRLTPDTG LPRAAFIVIR TDEGRVPVVD PDSRLVGLLS VKDIFKGLPE       120
     LELEDRPVSE YMTRKVVVCQ PEDSLSRVWL NMIHYGLTGF PVVGDRMEVI GMVTREDITK       180
     RGYARIERES EGKKNPTTVQ KIMSTPAITV EENDSIRKAA KIFMERNIGR VPVVMNGKLT       240
     GIVDRYDVIR ACRALQGVTP R                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page