(data stored in ACNUC10043 zone)

EMBL: AP011532.PE3

AP011532.PE3         Location/Qualifiers
FT   CDS             complement(2354..2851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0003"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60075"
FT                   /db_xref="GOA:D1YUF3"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUF3"
FT                   /protein_id="BAI60075.1"
FT                   /translation="MKGLLRDTALTLALVLALAGALYLYAGVWPPLVSVDGTSMYPNLM
FT                   PGDLIVLRGLDRVGVVPGCEAVNVSYSAFNGYGDVIVYIPMGDRNRTPVIHRAACWVSE
FT                   GQPMWPGGPSAPHSGFLTLGDNNFFYDQSTSISPDQPVRPEWVLGVSQFRIPYLGLLRS
FT                   FL"
     MKGLLRDTAL TLALVLALAG ALYLYAGVWP PLVSVDGTSM YPNLMPGDLI VLRGLDRVGV        60
     VPGCEAVNVS YSAFNGYGDV IVYIPMGDRN RTPVIHRAAC WVSEGQPMWP GGPSAPHSGF       120
     LTLGDNNFFY DQSTSISPDQ PVRPEWVLGV SQFRIPYLGL LRSFL                       165
//

If you have problems or comments...

PBIL Back to PBIL home page