(data stored in ACNUC10043 zone)

EMBL: AP011532.PE303

AP011532.PE303       Location/Qualifiers
FT   CDS             complement(305358..305828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60375"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVA3"
FT                   /protein_id="BAI60375.1"
FT                   /translation="MKILSVGIIVLLLGTLAVPAEAAAASDSDFRVTKMIVEPAGPDLN
FT                   FTVNYESGFFARVFSIIFGAKVLQPDILNVFANFSNVSLVSIDSNSGVAKVAVKNVSAL
FT                   NSDGWYIYDGNTTFTSKIAVIEIHNKDGTVVSLSDTNKLPVISSKMQVLSKK"
     MKILSVGIIV LLLGTLAVPA EAAAASDSDF RVTKMIVEPA GPDLNFTVNY ESGFFARVFS        60
     IIFGAKVLQP DILNVFANFS NVSLVSIDSN SGVAKVAVKN VSALNSDGWY IYDGNTTFTS       120
     KIAVIEIHNK DGTVVSLSDT NKLPVISSKM QVLSKK                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page