(data stored in ACNUC10043 zone)

EMBL: AP011532.PE305

AP011532.PE305       Location/Qualifiers
FT   CDS             306449..307252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domain (IPR001450)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60377"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVA5"
FT                   /protein_id="BAI60377.1"
FT                   /translation="MTLQSINIFGRRIITSMPDVRPENVKEDIAAIASKYGIEVVGFLG
FT                   LDERTKIPAEEMGLLRGVKWKDSEVDVSKVHDPLDIMPAARTMIILGKRLLDDSQDIYY
FT                   RASDDYTASVEMMLLDIASAKIVAGLKKGGFEAEEYTSYYLKAWAALAGLGWIGRSRMF
FT                   VSKAHGPRLRLHGILTDADIGELHAVIPDDSCGRCTECMKACPAGAISGDEVDRKKCGA
FT                   CPLNHRKISENALAYCTACTASCPVGRPSRHEHAVQAVSRQQITP"
     MTLQSINIFG RRIITSMPDV RPENVKEDIA AIASKYGIEV VGFLGLDERT KIPAEEMGLL        60
     RGVKWKDSEV DVSKVHDPLD IMPAARTMII LGKRLLDDSQ DIYYRASDDY TASVEMMLLD       120
     IASAKIVAGL KKGGFEAEEY TSYYLKAWAA LAGLGWIGRS RMFVSKAHGP RLRLHGILTD       180
     ADIGELHAVI PDDSCGRCTE CMKACPAGAI SGDEVDRKKC GACPLNHRKI SENALAYCTA       240
     CTASCPVGRP SRHEHAVQAV SRQQITP                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page