(data stored in ACNUC10043 zone)

EMBL: AP011532.PE311

AP011532.PE311       Location/Qualifiers
FT   CDS             312469..313818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60383"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB1"
FT                   /protein_id="BAI60383.1"
FT                   /translation="MTRILPGVEIQVIKEIVPQQLNPSGVVALIGTTEKGEALVPTPVS
FT                   SYAEFADKFGSSESFTVTKDAKQAFQNGVFQVVVVPISGQNGTKGTLVLKDRKGRDTVL
FT                   LTAKSSGEEGNKIMVKVEGDADSIRVSVSDGASLEIYEDVTMNSSSQNYLVDIINQRSA
FT                   MVTAEDQHSSAKFPHNNPAAVEGQLSGGVTGVISKADYEAALDKLEGEPDVDIVAACEV
FT                   SDPEIHALIEAHCLKMSIDAKNRIGLGSVAKGESIKDICNRTTVMASDRFVIVAPYGCL
FT                   GAVAGLMSRLNYYESPTFKPVSGLAKLEKKYTPSEQMEMLKAGVLPLEAQKGRGIVVVK
FT                   GISTSKEQISVTRIADHAVRGVKSVSDLFIGTLNSPTGRAALKGKIIEFFMRMESEGAI
FT                   VPSTDGKEPPFLVDVYSSELDFAQGIVRVNIAVRPVRAMDYIYATIKVEA"
     MTRILPGVEI QVIKEIVPQQ LNPSGVVALI GTTEKGEALV PTPVSSYAEF ADKFGSSESF        60
     TVTKDAKQAF QNGVFQVVVV PISGQNGTKG TLVLKDRKGR DTVLLTAKSS GEEGNKIMVK       120
     VEGDADSIRV SVSDGASLEI YEDVTMNSSS QNYLVDIINQ RSAMVTAEDQ HSSAKFPHNN       180
     PAAVEGQLSG GVTGVISKAD YEAALDKLEG EPDVDIVAAC EVSDPEIHAL IEAHCLKMSI       240
     DAKNRIGLGS VAKGESIKDI CNRTTVMASD RFVIVAPYGC LGAVAGLMSR LNYYESPTFK       300
     PVSGLAKLEK KYTPSEQMEM LKAGVLPLEA QKGRGIVVVK GISTSKEQIS VTRIADHAVR       360
     GVKSVSDLFI GTLNSPTGRA ALKGKIIEFF MRMESEGAIV PSTDGKEPPF LVDVYSSELD       420
     FAQGIVRVNI AVRPVRAMDY IYATIKVEA                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page