(data stored in ACNUC10043 zone)

EMBL: AP011532.PE313

AP011532.PE313       Location/Qualifiers
FT   CDS             314260..314616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60385"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB3"
FT                   /protein_id="BAI60385.1"
FT                   /translation="MKKLTKEDILKGKDKRETFRVDAYDSDVVLRPLTDGELSEVFAVI
FT                   GNVPLKSDGTPDGGQVDIVKNFKALRLVTSLGLVEPKLSVDEVGDMKFGVPEQIGTRIL
FT                   EISGISSAVKKELR"
     MKKLTKEDIL KGKDKRETFR VDAYDSDVVL RPLTDGELSE VFAVIGNVPL KSDGTPDGGQ        60
     VDIVKNFKAL RLVTSLGLVE PKLSVDEVGD MKFGVPEQIG TRILEISGIS SAVKKELR         118
//

If you have problems or comments...

PBIL Back to PBIL home page