(data stored in ACNUC10043 zone)

EMBL: AP011532.PE325

AP011532.PE325       Location/Qualifiers
FT   CDS             complement(325429..329370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0325"
FT                   /product="hypothetical protein"
FT                   /note="Contains at least one Bacterial Ig-like, group 1
FT                   domain (IPR003344).; Contains at least one Cna B-type
FT                   domain (IPR008454)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60397"
FT                   /db_xref="GOA:D1YVC5"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVC5"
FT                   /protein_id="BAI60397.1"
FT                   /translation="MRQIRLALFVLALALLPALISAEASGSALVYFNQTSESVGEGSTV
FT                   GLTIIYDNPDAWIIGGLPVTIKMRATGGNATYGTNYTATLNGVPFNSDGSATYVFTPVY
FT                   TYWHEIPVVFHASNSIANDVSQEFTLEVSGALYTYPGWPDRNTLHIDKLPTTQFQAVQE
FT                   SVNEGSSINVAVVRSGATYMPSSVDYTCMSNATRGGTFTVSPQPQTVNFAAGETVKYIT
FT                   VSTSVDGYFENDYNVTLQLSNPVGCRLVNTVKNNLTVTSSGSTPVVEFKETSESVDEGG
FT                   SVNLTVTREGDISNTASKVELSMDILPGTGYYAVTGNNATQLNNNNYQITFQKGEKEKT
FT                   ITINADSNLAYDDTRVIKFTLEAVNGGKALIGTKGSNDLTINDRTALPEIEFVLSGEAV
FT                   DEGNAIDITLCRTGATNIRSSVEFSYTVEGHSRDNFSVSPTNMVLFQPGQKTANITVTT
FT                   RDDVICGNDYRLDFTLTNPVNATIGNSMNALAVSDTTPYPVVSFTAGIASVNEGNTVSL
FT                   YLTRSGAKNVESRVVFQYDNTLSRNMYVSRFQADPALDSTSKCIITFAPNETGKTVNIS
FT                   VIEDNRTHDAQYAYFRLQPQDNVSIGSLDHVEVEVIDLSERVPEPYDVYFTESGFDANS
FT                   GGLCEIIIERSAYDRESSIIFYRASGSAASPDDYSTTAGLPYTVHFAVKERFQKITVLV
FT                   NSSAQGEKSVVFGLQKVSDDAVPGNPQTYTLSIHGLTPTPTPTPEPTPTPTPAPDVEQL
FT                   YVNANLDTEQIVAGYEGKITITVTDGTRPVSGAKVSIDRTGGQIIMLNSTTDGNGVCYA
FT                   TFKSDNPGQHSLTITATATGYDPGTAMLAASVVNAIPGALTVNAMVKQQPVVIGSEAEV
FT                   TVSVMDGGIPVPGASIKIETTSGSVTPSSGTTDSDGNMFAMFHSGDPGSYILTVTATAS
FT                   GHPASRVSYAVQVVGADERHLYAAMSVDPKSVSPNSKAEVTVTVTDGVMPVSNAQVSLV
FT                   ATGGTITPESGVTDSDGKFVAQYTAGSEGTYTLGVTAYSEGIGQASYSTFIKVKQGMFD
FT                   MQILIYFIIAVIIIAIVLIILVTLIEKWREYDLRVVPKVGAIPADGMSRLPVRIEVFNG
FT                   FGRPKKARSDTYVELESTAGRIESVTIPSGRNFADAVLTSSKEFGPVTIKAKIGDKANA
FT                   SVPVEFKLEGGSLAVTITPGMIIADSKSSASVNVRIRNSKGNYVVPLSDKVIELNTTLG
FT                   DIVGSIVNMPARANSANATIVSNKEGGIAMVTATMGTLKGTGRVEFRSMSRQLCANCGQ
FT                   PIPGSLPVCPSCGAPAVSADDKKATASMN"
     MRQIRLALFV LALALLPALI SAEASGSALV YFNQTSESVG EGSTVGLTII YDNPDAWIIG        60
     GLPVTIKMRA TGGNATYGTN YTATLNGVPF NSDGSATYVF TPVYTYWHEI PVVFHASNSI       120
     ANDVSQEFTL EVSGALYTYP GWPDRNTLHI DKLPTTQFQA VQESVNEGSS INVAVVRSGA       180
     TYMPSSVDYT CMSNATRGGT FTVSPQPQTV NFAAGETVKY ITVSTSVDGY FENDYNVTLQ       240
     LSNPVGCRLV NTVKNNLTVT SSGSTPVVEF KETSESVDEG GSVNLTVTRE GDISNTASKV       300
     ELSMDILPGT GYYAVTGNNA TQLNNNNYQI TFQKGEKEKT ITINADSNLA YDDTRVIKFT       360
     LEAVNGGKAL IGTKGSNDLT INDRTALPEI EFVLSGEAVD EGNAIDITLC RTGATNIRSS       420
     VEFSYTVEGH SRDNFSVSPT NMVLFQPGQK TANITVTTRD DVICGNDYRL DFTLTNPVNA       480
     TIGNSMNALA VSDTTPYPVV SFTAGIASVN EGNTVSLYLT RSGAKNVESR VVFQYDNTLS       540
     RNMYVSRFQA DPALDSTSKC IITFAPNETG KTVNISVIED NRTHDAQYAY FRLQPQDNVS       600
     IGSLDHVEVE VIDLSERVPE PYDVYFTESG FDANSGGLCE IIIERSAYDR ESSIIFYRAS       660
     GSAASPDDYS TTAGLPYTVH FAVKERFQKI TVLVNSSAQG EKSVVFGLQK VSDDAVPGNP       720
     QTYTLSIHGL TPTPTPTPEP TPTPTPAPDV EQLYVNANLD TEQIVAGYEG KITITVTDGT       780
     RPVSGAKVSI DRTGGQIIML NSTTDGNGVC YATFKSDNPG QHSLTITATA TGYDPGTAML       840
     AASVVNAIPG ALTVNAMVKQ QPVVIGSEAE VTVSVMDGGI PVPGASIKIE TTSGSVTPSS       900
     GTTDSDGNMF AMFHSGDPGS YILTVTATAS GHPASRVSYA VQVVGADERH LYAAMSVDPK       960
     SVSPNSKAEV TVTVTDGVMP VSNAQVSLVA TGGTITPESG VTDSDGKFVA QYTAGSEGTY      1020
     TLGVTAYSEG IGQASYSTFI KVKQGMFDMQ ILIYFIIAVI IIAIVLIILV TLIEKWREYD      1080
     LRVVPKVGAI PADGMSRLPV RIEVFNGFGR PKKARSDTYV ELESTAGRIE SVTIPSGRNF      1140
     ADAVLTSSKE FGPVTIKAKI GDKANASVPV EFKLEGGSLA VTITPGMIIA DSKSSASVNV      1200
     RIRNSKGNYV VPLSDKVIEL NTTLGDIVGS IVNMPARANS ANATIVSNKE GGIAMVTATM      1260
     GTLKGTGRVE FRSMSRQLCA NCGQPIPGSL PVCPSCGAPA VSADDKKATA SMN             1313
//

If you have problems or comments...

PBIL Back to PBIL home page