(data stored in ACNUC10043 zone)

EMBL: AP011532.PE333

AP011532.PE333       Location/Qualifiers
FT   CDS             complement(339006..339734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60405"
FT                   /db_xref="GOA:D1YVD3"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD3"
FT                   /protein_id="BAI60405.1"
FT                   /translation="MDSIASASVKYGSSRTRELLFRPLDLKFWLLATLGLSAGDPRQAE
FT                   MCRLRPYYRGTRLLATMGVLIILPAFLIPFMAPFIGSGGALVLVVLYLVFVLAMCLASL
FT                   FLEVSLDAVFAIGHEAGCGFSDAFRAFARFVREDPGNAAGYMGAKLLVDTGAMTIVSLF
FT                   FLPALFTMVFILSSVLHTLQAGQAVSRATAFGGLALVAVFCAAAMLASGLLSVPLSAFY
FT                   GYYTEETVRRICPVSYAARR"
     MDSIASASVK YGSSRTRELL FRPLDLKFWL LATLGLSAGD PRQAEMCRLR PYYRGTRLLA        60
     TMGVLIILPA FLIPFMAPFI GSGGALVLVV LYLVFVLAMC LASLFLEVSL DAVFAIGHEA       120
     GCGFSDAFRA FARFVREDPG NAAGYMGAKL LVDTGAMTIV SLFFLPALFT MVFILSSVLH       180
     TLQAGQAVSR ATAFGGLALV AVFCAAAMLA SGLLSVPLSA FYGYYTEETV RRICPVSYAA       240
     RR                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page