(data stored in ACNUC10043 zone)

EMBL: AP011532.PE336

AP011532.PE336       Location/Qualifiers
FT   CDS             complement(341131..342180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60408"
FT                   /db_xref="GOA:D1YVD6"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD6"
FT                   /protein_id="BAI60408.1"
FT                   /translation="MTEWWAFKPITTAFEKAKKILLEPFNAWAWLKLMIIVFFVGTGSS
FT                   RISNQFSNMANYRTGPEDTAGIEQGITSLLSNSTILAIIIVAALLIILVAVLFAYLRNV
FT                   FSFVLIKALTSGDVHIIQPLKENLGRGFRLFVFTLAASILTLVVVLAFIAIAILLILLA
FT                   VQAGTSSAAGIVTLILVICVICLLILLMVLFSIAMGIFIGFTYDFVAPMVYFKGRGIVE
FT                   SWKWLWASIKKDWQQYGVYVITRWALELAVGLLSMIIIVPVALIFIAILVAGCILAAAV
FT                   AKTSVALAVVIGLVLLVVLALFLIALMAISMPIAVYFRYYSLDVLKHIDPSAVIYSERF
FT                   APPPATLPA"
     MTEWWAFKPI TTAFEKAKKI LLEPFNAWAW LKLMIIVFFV GTGSSRISNQ FSNMANYRTG        60
     PEDTAGIEQG ITSLLSNSTI LAIIIVAALL IILVAVLFAY LRNVFSFVLI KALTSGDVHI       120
     IQPLKENLGR GFRLFVFTLA ASILTLVVVL AFIAIAILLI LLAVQAGTSS AAGIVTLILV       180
     ICVICLLILL MVLFSIAMGI FIGFTYDFVA PMVYFKGRGI VESWKWLWAS IKKDWQQYGV       240
     YVITRWALEL AVGLLSMIII VPVALIFIAI LVAGCILAAA VAKTSVALAV VIGLVLLVVL       300
     ALFLIALMAI SMPIAVYFRY YSLDVLKHID PSAVIYSERF APPPATLPA                   349
//

If you have problems or comments...

PBIL Back to PBIL home page