(data stored in ACNUC10043 zone)

EMBL: AP011532.PE34

AP011532.PE34        Location/Qualifiers
FT   CDS             25082..26992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0034"
FT                   /product="putative histidine kinase"
FT                   /note="Contains at least two PAS domains (IPR000014).;
FT                   Contains two PAS-associated, C-terminal domains
FT                   (IPR000700).; Contains one ATP-binding region, ATPase-like
FT                   domain (IPR003594).; Contains one histidine kinase A,
FT                   N-terminal domain (IPR003661).; Contains two PAC motif
FT                   repeats (IPR001610)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60106"
FT                   /db_xref="GOA:D1YUI4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI4"
FT                   /protein_id="BAI60106.1"
FT                   /translation="MSFKPAPSNPPDAGRTTEELLSELQALRARNAALEESEQRYREAV
FT                   ESANSIIIRWDMEGNLTFFNEFAEKLFGFSEDEVLGRNVVGTIVPPSESTGRDLAAMID
FT                   DVLAHPERYELNINENICKNGERVTIAWTNRAIRDEHGNAVEILSVGNDITERRRAEES
FT                   LQFERLQLLSIFDSIDEVIYISDPCTYEILYANKAMQDKFGKSLIGGICYREIQDRDAP
FT                   CDFCTNGIILNNKDEPCRWEFHNPTVNRDFGIVDRIIKWPDGRDVRFEIALDITERNQA
FT                   SESLRESEEDLRAAFEQAAVGMTHVSSDGRFLKVNQKFCDITGYTREELLKMSAQDITH
FT                   PTDMDEEARLIESLLSGRLSTFSSEKRYIRKDGAVVWVNLTVTPIFHNGALAYLMGITE
FT                   DITGRKQAEAALQEAKAQAELYVDLMGHDINNIHQAALGYLELARDMPGDREEHLDMAI
FT                   EALMRSTRLISNVRKLQKIPNAGHAHEVDLCEVLGEVYGEYARSPGKTVMLSLNGREHC
FT                   HVLADDLLRDVFSNLVGNAVKHTGKRASVLISLDEAQEGGKAHYRVSVEDDGPGIRDEL
FT                   KKTLFSRSLKGSPRAKGMGLGLYIVKTLVGNYGGIIRVEDRVRGDHAKGARFVILLPMI
FT                   K"
     MSFKPAPSNP PDAGRTTEEL LSELQALRAR NAALEESEQR YREAVESANS IIIRWDMEGN        60
     LTFFNEFAEK LFGFSEDEVL GRNVVGTIVP PSESTGRDLA AMIDDVLAHP ERYELNINEN       120
     ICKNGERVTI AWTNRAIRDE HGNAVEILSV GNDITERRRA EESLQFERLQ LLSIFDSIDE       180
     VIYISDPCTY EILYANKAMQ DKFGKSLIGG ICYREIQDRD APCDFCTNGI ILNNKDEPCR       240
     WEFHNPTVNR DFGIVDRIIK WPDGRDVRFE IALDITERNQ ASESLRESEE DLRAAFEQAA       300
     VGMTHVSSDG RFLKVNQKFC DITGYTREEL LKMSAQDITH PTDMDEEARL IESLLSGRLS       360
     TFSSEKRYIR KDGAVVWVNL TVTPIFHNGA LAYLMGITED ITGRKQAEAA LQEAKAQAEL       420
     YVDLMGHDIN NIHQAALGYL ELARDMPGDR EEHLDMAIEA LMRSTRLISN VRKLQKIPNA       480
     GHAHEVDLCE VLGEVYGEYA RSPGKTVMLS LNGREHCHVL ADDLLRDVFS NLVGNAVKHT       540
     GKRASVLISL DEAQEGGKAH YRVSVEDDGP GIRDELKKTL FSRSLKGSPR AKGMGLGLYI       600
     VKTLVGNYGG IIRVEDRVRG DHAKGARFVI LLPMIK                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page