(data stored in ACNUC10043 zone)

EMBL: AP011532.PE347

AP011532.PE347       Location/Qualifiers
FT   CDS             complement(352263..352457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0347"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60419"
FT                   /db_xref="InterPro:IPR035258"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE7"
FT                   /protein_id="BAI60419.1"
FT                   /translation="MGKTGSVEWVQIRGRKGQMRLVPRGDSVAGKPGPAQRYDAKGFVR
FT                   RILARSKKNVLGVKSKSKK"
     MGKTGSVEWV QIRGRKGQMR LVPRGDSVAG KPGPAQRYDA KGFVRRILAR SKKNVLGVKS        60
     KSKK                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page