(data stored in ACNUC10043 zone)

EMBL: AP011532.PE355

AP011532.PE355       Location/Qualifiers
FT   CDS             complement(359536..359895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Cupin 2, conserved barrel domain
FT                   (IPR013096)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60427"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF5"
FT                   /protein_id="BAI60427.1"
FT                   /translation="MMHNRSNISSYVTKDGSRIWELFHPGSSPVAGFSVAEARVDAGQE
FT                   TVAHVHHRSQEVYYILEGCGEMSLGGDALAVIQGDAILILPGKRHNIKNTGVGALRILC
FT                   ICSPPYAHEDTGTGL"
     MMHNRSNISS YVTKDGSRIW ELFHPGSSPV AGFSVAEARV DAGQETVAHV HHRSQEVYYI        60
     LEGCGEMSLG GDALAVIQGD AILILPGKRH NIKNTGVGAL RILCICSPPY AHEDTGTGL        119
//

If you have problems or comments...

PBIL Back to PBIL home page