(data stored in ACNUC10043 zone)

EMBL: AP011532.PE356

AP011532.PE356       Location/Qualifiers
FT   CDS             359968..360828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Beta-lactamase-like domain
FT                   (IPR001279)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60428"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF6"
FT                   /protein_id="BAI60428.1"
FT                   /translation="MASKSNGPALVAGNSYYLPAMSNAGLFKGYVIDPGSVGYADVGRD
FT                   DIHTVLITHGHNDHFRRAREFRERGARVIASKEDALLVRNPEVNVRGLFSWARPPKEMI
FT                   TPYFQGDACEVDLYIEDWLDSSIRAIYLPGHTLGEYGFITEDGVLYSADSLYSKELWGK
FT                   YKLPYSIDPDLCRESIRKIKTLDFDYLVPGHGDPLSREDALKAADFHLSQLDFVDEVVL
FT                   ELLREPVSTESLVTKFCYELDLYKSLNNYWLTLVMLKGHLSSLNHQGRVAYKLENYCMF
FT                   WFKSK"
     MASKSNGPAL VAGNSYYLPA MSNAGLFKGY VIDPGSVGYA DVGRDDIHTV LITHGHNDHF        60
     RRAREFRERG ARVIASKEDA LLVRNPEVNV RGLFSWARPP KEMITPYFQG DACEVDLYIE       120
     DWLDSSIRAI YLPGHTLGEY GFITEDGVLY SADSLYSKEL WGKYKLPYSI DPDLCRESIR       180
     KIKTLDFDYL VPGHGDPLSR EDALKAADFH LSQLDFVDEV VLELLREPVS TESLVTKFCY       240
     ELDLYKSLNN YWLTLVMLKG HLSSLNHQGR VAYKLENYCM FWFKSK                      286
//

If you have problems or comments...

PBIL Back to PBIL home page