(data stored in ACNUC10043 zone)

EMBL: AP011532.PE358

AP011532.PE358       Location/Qualifiers
FT   CDS             complement(362435..363310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0358"
FT                   /product="peptidase M48, Ste24p family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60430"
FT                   /db_xref="GOA:D1YVF8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF8"
FT                   /protein_id="BAI60430.1"
FT                   /translation="MKDIPGQRYITGMNASKKNGADEYYVSGERRQGITFYIILALILG
FT                   LVIILAAEAYRSLSPLGMETFWSFAYLAASLAVGATAGIILFNSFNSYRIIQAMLRNSL
FT                   KASPHAFPEIYDIVGLAAERLHVQAPDTYVSQSPAVNAYLVRLGLRKKVIIINTGLLRA
FT                   MDQDELLFILGHEISHAKYGRWRRIPGLGLPYVIAPQYNEYRCDRGGLVASRNIDASVR
FT                   ALLKLVTGKEFIDRVSVKDLANEKGEAPPSEAPSKVLQRLASHPMIGARIKELMKFHSS
FT                   PAYTAYQNIS"
     MKDIPGQRYI TGMNASKKNG ADEYYVSGER RQGITFYIIL ALILGLVIIL AAEAYRSLSP        60
     LGMETFWSFA YLAASLAVGA TAGIILFNSF NSYRIIQAML RNSLKASPHA FPEIYDIVGL       120
     AAERLHVQAP DTYVSQSPAV NAYLVRLGLR KKVIIINTGL LRAMDQDELL FILGHEISHA       180
     KYGRWRRIPG LGLPYVIAPQ YNEYRCDRGG LVASRNIDAS VRALLKLVTG KEFIDRVSVK       240
     DLANEKGEAP PSEAPSKVLQ RLASHPMIGA RIKELMKFHS SPAYTAYQNI S                291
//

If you have problems or comments...

PBIL Back to PBIL home page