(data stored in ACNUC10043 zone)

EMBL: AP011532.PE36

AP011532.PE36        Location/Qualifiers
FT   CDS             27321..27503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60108"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI6"
FT                   /protein_id="BAI60108.1"
FT                   /translation="MRTAILFLVIVLLIAAPLPACEAAPGNIVHAADDGYGLGCPGCPG
FT                   CPDNPVRDPNAPACF"
     MRTAILFLVI VLLIAAPLPA CEAAPGNIVH AADDGYGLGC PGCPGCPDNP VRDPNAPACF        60
//

If you have problems or comments...

PBIL Back to PBIL home page