(data stored in ACNUC10043 zone)

EMBL: AP011532.PE369

AP011532.PE369       Location/Qualifiers
FT   CDS             complement(375593..376240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0369"
FT                   /product="hypothetical protein"
FT                   /note="Contains one Beta-Ig-H3/fasciclin domain
FT                   (IPR000782)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60441"
FT                   /db_xref="GOA:D1YVG9"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG9"
FT                   /protein_id="BAI60441.1"
FT                   /translation="MSGIKKYITILLLLALAAGLAAPFVNAQVGSQRTVLENLANIGQF
FT                   STFLGAVRAAGLDNVLKGPGEFTVFAPTNAAFDKLPKNQLNALMQDQPRLSSLLQYHAV
FT                   PGRLTFADLSRMTDVKTVDGKTLPINIKDGGLVVGGSRVLNQGVECKNGIIYPVDSVMM
FT                   PPGFTMAQKTQSSPLGWLPWLLAALVIGAGALYLMTRRKNREEPRVEEKKGP"
     MSGIKKYITI LLLLALAAGL AAPFVNAQVG SQRTVLENLA NIGQFSTFLG AVRAAGLDNV        60
     LKGPGEFTVF APTNAAFDKL PKNQLNALMQ DQPRLSSLLQ YHAVPGRLTF ADLSRMTDVK       120
     TVDGKTLPIN IKDGGLVVGG SRVLNQGVEC KNGIIYPVDS VMMPPGFTMA QKTQSSPLGW       180
     LPWLLAALVI GAGALYLMTR RKNREEPRVE EKKGP                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page