(data stored in ACNUC10043 zone)

EMBL: AP011532.PE372

AP011532.PE372       Location/Qualifiers
FT   CDS             378361..379488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0372"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60444"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH2"
FT                   /protein_id="BAI60444.1"
FT                   /translation="MINLAQTNESLAIDKGKLIFFVVFDTGGEVDKATLSGIFKVQAGP
FT                   EYSKPVETTLGQMTGLIVSDNNKICKVLAQAEVFAMGVGIIRVEFELAEGMLVKEIITA
FT                   MHSNGIFLDGLDLNAYVARKIGEIREQLKAYAKLKIYYTPTRKYSMLRLDQYTPPVDQG
FT                   ELKVQYGAELTRFLSGESSARRLHGKEIADKLSHDISYYDEDLFLVSYEAAFVKGCDDY
FT                   FNDLRHYLELGLALAFLYQIYDWKMDAEIGEAFKAIRNYQTQSTIGQLFSQSTKRLEKA
FT                   LLKVSEIKLDILDNLEDLMNPLKVTSDWYYQGAYEHIIRLIKVREYESIVTQKIDALED
FT                   LYSTAQELSYSKIALITEVVVILLIAFEVIAFLPH"
     MINLAQTNES LAIDKGKLIF FVVFDTGGEV DKATLSGIFK VQAGPEYSKP VETTLGQMTG        60
     LIVSDNNKIC KVLAQAEVFA MGVGIIRVEF ELAEGMLVKE IITAMHSNGI FLDGLDLNAY       120
     VARKIGEIRE QLKAYAKLKI YYTPTRKYSM LRLDQYTPPV DQGELKVQYG AELTRFLSGE       180
     SSARRLHGKE IADKLSHDIS YYDEDLFLVS YEAAFVKGCD DYFNDLRHYL ELGLALAFLY       240
     QIYDWKMDAE IGEAFKAIRN YQTQSTIGQL FSQSTKRLEK ALLKVSEIKL DILDNLEDLM       300
     NPLKVTSDWY YQGAYEHIIR LIKVREYESI VTQKIDALED LYSTAQELSY SKIALITEVV       360
     VILLIAFEVI AFLPH                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page