(data stored in ACNUC10043 zone)

EMBL: AP011532.PE377

AP011532.PE377       Location/Qualifiers
FT   CDS             382089..382874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0377"
FT                   /product="peptidase S54, rhomboid family protein"
FT                   /note="Contains one Zinc finger, AN1-type domain
FT                   (IPR000058)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60449"
FT                   /db_xref="GOA:D1YVH7"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH7"
FT                   /protein_id="BAI60449.1"
FT                   /translation="MPENRCDVCSAFELLPFKCKYCGGTFCGAHRLPESHNCPGLRMLK
FT                   QRPAADSRATVKRRSALRLPAAKLPYSGYYAYALIAITVIVYVLQVLFPGITDALILSS
FT                   SNLLSHPWGILTSIFLHSSLMHLFFNMLALFFFGPLLERRIGSGRFLGLYFGTGIIAGL
FT                   AQILAFPGSAVLGASGAIFGVLGTLTVLTPDLVVYLYFVPLKMVYVTILFAVLDLFPVL
FT                   TGTSDGVAHIAHLAGLAIGLAAGFWYRQKSKIRSVRWQV"
     MPENRCDVCS AFELLPFKCK YCGGTFCGAH RLPESHNCPG LRMLKQRPAA DSRATVKRRS        60
     ALRLPAAKLP YSGYYAYALI AITVIVYVLQ VLFPGITDAL ILSSSNLLSH PWGILTSIFL       120
     HSSLMHLFFN MLALFFFGPL LERRIGSGRF LGLYFGTGII AGLAQILAFP GSAVLGASGA       180
     IFGVLGTLTV LTPDLVVYLY FVPLKMVYVT ILFAVLDLFP VLTGTSDGVA HIAHLAGLAI       240
     GLAAGFWYRQ KSKIRSVRWQ V                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page