(data stored in ACNUC10043 zone)

EMBL: AP011532.PE380

AP011532.PE380       Location/Qualifiers
FT   CDS             384443..385195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0380"
FT                   /product="putative cobalt ABC transporter ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60452"
FT                   /db_xref="GOA:D1YVI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI0"
FT                   /protein_id="BAI60452.1"
FT                   /translation="MISLRDVSFSYGCLSALDHISLQVEKGEHMALIGPNASGKTTLAM
FT                   VMNALLTPDRGECLVEGIDTRDDPMFARRTVGMVFQDPESQTVARRVWDDVAFGPMNLG
FT                   LPDGEVEKRVRESLDHVGLGAFSRREVSCLSGGQKQLLAVAGILAMKPSYIVFDEPTAL
FT                   LDGPGCRMVNKAVAGLKKNGIGIITITHDMEEALTADRIVALDTGRIVADMPPASLFSD
FT                   EALMARIGIKPPYTFNLAVPREVVRECR"
     MISLRDVSFS YGCLSALDHI SLQVEKGEHM ALIGPNASGK TTLAMVMNAL LTPDRGECLV        60
     EGIDTRDDPM FARRTVGMVF QDPESQTVAR RVWDDVAFGP MNLGLPDGEV EKRVRESLDH       120
     VGLGAFSRRE VSCLSGGQKQ LLAVAGILAM KPSYIVFDEP TALLDGPGCR MVNKAVAGLK       180
     KNGIGIITIT HDMEEALTAD RIVALDTGRI VADMPPASLF SDEALMARIG IKPPYTFNLA       240
     VPREVVRECR                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page