(data stored in ACNUC10043 zone)

EMBL: AP011532.PE386

AP011532.PE386       Location/Qualifiers
FT   CDS             complement(391592..392179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60458"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI6"
FT                   /protein_id="BAI60458.1"
FT                   /translation="MADVASTPELRKRLFDIKRDHSHDEAVILIEAMLKEEYSRLEPII
FT                   KKEREAYLRMDVDDAGQQNDIADLRLSAVEAYQPSYIIENFLADMKVDILPLLPKYEGR
FT                   FEVSSRGGDIWTLSVASLKENAMRTLGGHCNVVGDVIVLERLLYDHAYLAAVMKLTDDY
FT                   EPGKPSYVEFDFYTVVFDEEVQALVKVPLDAK"
     MADVASTPEL RKRLFDIKRD HSHDEAVILI EAMLKEEYSR LEPIIKKERE AYLRMDVDDA        60
     GQQNDIADLR LSAVEAYQPS YIIENFLADM KVDILPLLPK YEGRFEVSSR GGDIWTLSVA       120
     SLKENAMRTL GGHCNVVGDV IVLERLLYDH AYLAAVMKLT DDYEPGKPSY VEFDFYTVVF       180
     DEEVQALVKV PLDAK                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page