(data stored in ACNUC10043 zone)

EMBL: AP011532.PE394

AP011532.PE394       Location/Qualifiers
FT   CDS             complement(395924..396331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0394"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60466"
FT                   /db_xref="GOA:D1YVJ4"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVJ4"
FT                   /protein_id="BAI60466.1"
FT                   /translation="MSDKNKPADPWLYRVSLWLGSAALVIAGIVLIIWKSMDDVLAIVV
FT                   LSGILVLLSNFFAYIGMEKPLKDERVKKIGTISATYSWFITLAFMGFLLISGYWSHRVF
FT                   TPEELFGLIFVVMLLSMLVINAYLGGKADVE"
     MSDKNKPADP WLYRVSLWLG SAALVIAGIV LIIWKSMDDV LAIVVLSGIL VLLSNFFAYI        60
     GMEKPLKDER VKKIGTISAT YSWFITLAFM GFLLISGYWS HRVFTPEELF GLIFVVMLLS       120
     MLVINAYLGG KADVE                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page