(data stored in ACNUC10043 zone)

EMBL: AP011532.PE404

AP011532.PE404       Location/Qualifiers
FT   CDS             408913..409065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one YHS domain (IPR007029).; Contains one
FT                   TRASH domain (IPR011017)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60476"
FT                   /db_xref="GOA:D1YVK4"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVK4"
FT                   /protein_id="BAI60476.1"
FT                   /translation="MMVKDPVCHMNVNEEKPGAKENFHGKTYFFCSNKCKATFDKNRDR
FT                   FAKEE"
     MMVKDPVCHM NVNEEKPGAK ENFHGKTYFF CSNKCKATFD KNRDRFAKEE                   50
//

If you have problems or comments...

PBIL Back to PBIL home page