(data stored in ACNUC10043 zone)

EMBL: AP011532.PE421

AP011532.PE421       Location/Qualifiers
FT   CDS             complement(422806..423195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60493"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM1"
FT                   /protein_id="BAI60493.1"
FT                   /translation="MDVLLSIKPKYANKIIDGEKKFEFRKIKLDKRKIGHIYIYSTSPV
FT                   KKIIAKIAIGDIIEDSPERLWKRCEKHSGISKEEFFSYYAEKEVGFAITIKKVEPLDVP
FT                   IDPYVKIENFTPPQSYYYLKDGSLF"
     MDVLLSIKPK YANKIIDGEK KFEFRKIKLD KRKIGHIYIY STSPVKKIIA KIAIGDIIED        60
     SPERLWKRCE KHSGISKEEF FSYYAEKEVG FAITIKKVEP LDVPIDPYVK IENFTPPQSY       120
     YYLKDGSLF                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page