(data stored in ACNUC10043 zone)

EMBL: AP011532.PE427

AP011532.PE427       Location/Qualifiers
FT   CDS             427833..428579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60499"
FT                   /db_xref="GOA:D1YVM7"
FT                   /db_xref="InterPro:IPR025495"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM7"
FT                   /protein_id="BAI60499.1"
FT                   /translation="MKGIVMDTEIRAESPVKYAPRLLGAAFLFVILTSLAGGLLLKSAA
FT                   GSGSIADVLVNVSQNPTLFRIDILDGLLNSTGIVALAGLLYVVLRQQNKPLARIALGLW
FT                   LAEAIFYAIIQMGLLALIPLSAEFVAAGAPAGSFYLTLGDFLYNGVYAQGMTIHMWFYC
FT                   MGGLIWYYLFYRSNYIPRAISLFGLLAVILGLGSVVFQLLGYEVPILVSLPLLPFELAI
FT                   GAWLLFLGIREQATAVNPSRQPAVQG"
     MKGIVMDTEI RAESPVKYAP RLLGAAFLFV ILTSLAGGLL LKSAAGSGSI ADVLVNVSQN        60
     PTLFRIDILD GLLNSTGIVA LAGLLYVVLR QQNKPLARIA LGLWLAEAIF YAIIQMGLLA       120
     LIPLSAEFVA AGAPAGSFYL TLGDFLYNGV YAQGMTIHMW FYCMGGLIWY YLFYRSNYIP       180
     RAISLFGLLA VILGLGSVVF QLLGYEVPIL VSLPLLPFEL AIGAWLLFLG IREQATAVNP       240
     SRQPAVQG                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page