(data stored in ACNUC10043 zone)

EMBL: AP011532.PE43

AP011532.PE43        Location/Qualifiers
FT   CDS             complement(33632..34081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Sjogrens syndrome scleroderma
FT                   autoantigen 1family (IPR009563)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60115"
FT                   /db_xref="InterPro:IPR009563"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ3"
FT                   /protein_id="BAI60115.1"
FT                   /translation="MEDKDLEKVTKMLERGGTMLAKHCECGAPLFKYQGKVVCPICDAK
FT                   KEEHAQTQEQARLAVPVETRPAVSPQAMETVKSTPIMEIPERRMSVVVGSEELDDAAVE
FT                   AAVIAKINDIAVRLASETYPNKIQIYLDILERSLRVLKELHGISR"
     MEDKDLEKVT KMLERGGTML AKHCECGAPL FKYQGKVVCP ICDAKKEEHA QTQEQARLAV        60
     PVETRPAVSP QAMETVKSTP IMEIPERRMS VVVGSEELDD AAVEAAVIAK INDIAVRLAS       120
     ETYPNKIQIY LDILERSLRV LKELHGISR                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page