(data stored in ACNUC10043 zone)

EMBL: AP011532.PE430

AP011532.PE430       Location/Qualifiers
FT   CDS             complement(430609..431226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60502"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN0"
FT                   /protein_id="BAI60502.1"
FT                   /translation="MVFTLIVFSSAMFAGMQAEKAEANANLTAYKTVPPNSWEPMGYNM
FT                   TGTAPYFITHTLNWSNTRIMGNLGIGDGSVRTLNDTSNRDVNYTDNNFMAADISMAPWD
FT                   PGRLTALNPLAGTTNATQAVVNETGNATNETVGNVTESSSINFNRPLSDPYHPILMGRP
FT                   VDDLLYEYPLATPINMYARLLGLRMPGGSCLNMGVKCLGYGY"
     MVFTLIVFSS AMFAGMQAEK AEANANLTAY KTVPPNSWEP MGYNMTGTAP YFITHTLNWS        60
     NTRIMGNLGI GDGSVRTLND TSNRDVNYTD NNFMAADISM APWDPGRLTA LNPLAGTTNA       120
     TQAVVNETGN ATNETVGNVT ESSSINFNRP LSDPYHPILM GRPVDDLLYE YPLATPINMY       180
     ARLLGLRMPG GSCLNMGVKC LGYGY                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page