(data stored in ACNUC10043 zone)

EMBL: AP011532.PE431

AP011532.PE431       Location/Qualifiers
FT   CDS             431524..431853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0431"
FT                   /product="putative nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60503"
FT                   /db_xref="GOA:D1YVN1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN1"
FT                   /protein_id="BAI60503.1"
FT                   /translation="MKMVQAIIRPERLDGVKKALEEKGFIALSITEMRGRGEQKGIRLS
FT                   HRGRPLEVDVLPKVKLELVVDDEHVDPIVSIIRGSARTGKVGDGKIFVLPVDMMCKVRT
FT                   DEVWK"
     MKMVQAIIRP ERLDGVKKAL EEKGFIALSI TEMRGRGEQK GIRLSHRGRP LEVDVLPKVK        60
     LELVVDDEHV DPIVSIIRGS ARTGKVGDGK IFVLPVDMMC KVRTDEVWK                   109
//

If you have problems or comments...

PBIL Back to PBIL home page