(data stored in ACNUC10043 zone)

EMBL: AP011532.PE44

AP011532.PE44        Location/Qualifiers
FT   CDS             complement(34329..35135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains at least one 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain (IPR001450)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ4"
FT                   /protein_id="BAI60116.1"
FT                   /translation="MSRSIWLVALIKKTFSGRFTLARTTGLPVIGGIVDHLFFRDDRMV
FT                   YLPMDRVVQINKKLEEPSQSFLPSAVAEHFVRSASRRWVMNECICRSASHCEDYPAGLG
FT                   CLFLGEAAAHIDPRLGRPVSEAEALEHLKKCRDAGLVHMIGRDRLDAVWLGVSPGHKLM
FT                   TICSCCPCCCLWKMLPVLSGDIGSRFVKMPGVSVSVRDSCIGCGKCERACFLSAIKVVD
FT                   GRAAIGGDCRGCGRCADVCPSKAIVVSVDDRMAEAIAMVTSSADIS"
     MSRSIWLVAL IKKTFSGRFT LARTTGLPVI GGIVDHLFFR DDRMVYLPMD RVVQINKKLE        60
     EPSQSFLPSA VAEHFVRSAS RRWVMNECIC RSASHCEDYP AGLGCLFLGE AAAHIDPRLG       120
     RPVSEAEALE HLKKCRDAGL VHMIGRDRLD AVWLGVSPGH KLMTICSCCP CCCLWKMLPV       180
     LSGDIGSRFV KMPGVSVSVR DSCIGCGKCE RACFLSAIKV VDGRAAIGGD CRGCGRCADV       240
     CPSKAIVVSV DDRMAEAIAM VTSSADIS                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page