(data stored in ACNUC10043 zone)

EMBL: AP011532.PE443

AP011532.PE443       Location/Qualifiers
FT   CDS             444783..445307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0443"
FT                   /product="hypothetical protein"
FT                   /note="Contains at least Tetratricopeptide region domains
FT                   (IPR013026).; Contains at least three Tetratricopeptide
FT                   TPR_1 repeats (IPR001440).; Contains for Tetratricopeptide
FT                   TPR_2repeats (IPR013105)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60515"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVP3"
FT                   /protein_id="BAI60515.1"
FT                   /translation="MCEDPHPSSPGPKKPKKLSEEMDADSHIREGNALLLVGRIDEAIE
FT                   EYRAALDKDPENAEVHYNLGLIYRKTMQLDDAIREYREAIRVDPGNMKYHNNLAAALVV
FT                   KGQKSEAVKEYEEALRIEPKNATLHFNRGFALDEMGELQEAKKEYEEALRIDPGFDHAM
FT                   FYLGMLKKKLK"
     MCEDPHPSSP GPKKPKKLSE EMDADSHIRE GNALLLVGRI DEAIEEYRAA LDKDPENAEV        60
     HYNLGLIYRK TMQLDDAIRE YREAIRVDPG NMKYHNNLAA ALVVKGQKSE AVKEYEEALR       120
     IEPKNATLHF NRGFALDEMG ELQEAKKEYE EALRIDPGFD HAMFYLGMLK KKLK             174
//

If you have problems or comments...

PBIL Back to PBIL home page