(data stored in ACNUC10043 zone)

EMBL: AP011532.PE453

AP011532.PE453       Location/Qualifiers
FT   CDS             complement(454168..455610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0453"
FT                   /product="dihydropteroate synthase-related protein"
FT                   /note="Belongs to the Dihydropteroate synthase-related
FT                   protein synthase-related protein family (IPR005236)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0453"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60525"
FT                   /db_xref="GOA:D1YVQ3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR005236"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ3"
FT                   /protein_id="BAI60525.1"
FT                   /translation="MRILLVTGRLAYPVVKELAGDADVLMLDVGVAAFITPKLLEKAIA
FT                   PVKGDYDLVLVTGLAASDFSGLEKKLGVKIRLGPKQAYDIPLALAAAGRVEFSSKVPAD
FT                   MLLANVKRESALKELGDIEAGASCAFSLKGVKIGGTSTMKVVAEVADATKLTDVELVSK
FT                   IESYAAADVIDLGVPLESSEDAVRHAVRVARSVTRKPLSVDTLIPEYIRAGIGEGAGLV
FT                   LSLNGSNLDEVGPLVAEKGLAAVVIPNDESLDELFVNIEKARALGIKSILADPILSPVG
FT                   HGLADSLERYREFRRREPDMPLFFGAGNVTELMDADSVGINALLAGIAMELGVSALFTT
FT                   EASHKTVNCAYELKTACDMMALAKKHKGSPKDLGIDLLIIKEKRARRDMVEPGPTVIEA
FT                   KRHELKLDPAGNFNIYVKDGRIYVNNGSVTVVGDEPMTIIETLADMGLMSMLDHAGYLG
FT                   KELEKARLAIRFKRSYLQDDPF"
     MRILLVTGRL AYPVVKELAG DADVLMLDVG VAAFITPKLL EKAIAPVKGD YDLVLVTGLA        60
     ASDFSGLEKK LGVKIRLGPK QAYDIPLALA AAGRVEFSSK VPADMLLANV KRESALKELG       120
     DIEAGASCAF SLKGVKIGGT STMKVVAEVA DATKLTDVEL VSKIESYAAA DVIDLGVPLE       180
     SSEDAVRHAV RVARSVTRKP LSVDTLIPEY IRAGIGEGAG LVLSLNGSNL DEVGPLVAEK       240
     GLAAVVIPND ESLDELFVNI EKARALGIKS ILADPILSPV GHGLADSLER YREFRRREPD       300
     MPLFFGAGNV TELMDADSVG INALLAGIAM ELGVSALFTT EASHKTVNCA YELKTACDMM       360
     ALAKKHKGSP KDLGIDLLII KEKRARRDMV EPGPTVIEAK RHELKLDPAG NFNIYVKDGR       420
     IYVNNGSVTV VGDEPMTIIE TLADMGLMSM LDHAGYLGKE LEKARLAIRF KRSYLQDDPF       480
//

If you have problems or comments...

PBIL Back to PBIL home page