(data stored in ACNUC10043 zone)

EMBL: AP011532.PE457

AP011532.PE457       Location/Qualifiers
FT   CDS             457154..457672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60529"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ7"
FT                   /protein_id="BAI60529.1"
FT                   /translation="MDKYVNFAKTWKSVGVTNRLRWQQNNSLGRFNKYLLIRFIDRYGE
FT                   KALEVISETGLAVGYDDGKKIVDNLNLDSNSLRALLIPMEAISLLAGVDSDILVESSYG
FT                   PGTICLKVGDCIYATLFDGMNVGADFKTNACVSYSTGLTHAVSERSKVKVVKRRCAGDK
FT                   YCEFVVSLG"
     MDKYVNFAKT WKSVGVTNRL RWQQNNSLGR FNKYLLIRFI DRYGEKALEV ISETGLAVGY        60
     DDGKKIVDNL NLDSNSLRAL LIPMEAISLL AGVDSDILVE SSYGPGTICL KVGDCIYATL       120
     FDGMNVGADF KTNACVSYST GLTHAVSERS KVKVVKRRCA GDKYCEFVVS LG               172
//

If you have problems or comments...

PBIL Back to PBIL home page