(data stored in ACNUC10043 zone)

EMBL: AP011532.PE465

AP011532.PE465       Location/Qualifiers
FT   CDS             complement(463028..463558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60537"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVR5"
FT                   /protein_id="BAI60537.1"
FT                   /translation="MKLDKEPCGLRILTEIVINRSGINYDDYLLGRTCRRCKRLMLEGN
FT                   ITKIPEDSNFRIVVKTPDGMPNILKGSELLTVSCKCGATYNIIFYGPVQYNSAGIVAYT
FT                   IIQMNGAEVELSDALDDMRKHKDAPADVDRWIVETLADEFNDAVRIVNEKGVSLVEEDW
FT                   TESKYSTGWIEEE"
     MKLDKEPCGL RILTEIVINR SGINYDDYLL GRTCRRCKRL MLEGNITKIP EDSNFRIVVK        60
     TPDGMPNILK GSELLTVSCK CGATYNIIFY GPVQYNSAGI VAYTIIQMNG AEVELSDALD       120
     DMRKHKDAPA DVDRWIVETL ADEFNDAVRI VNEKGVSLVE EDWTESKYST GWIEEE           176
//

If you have problems or comments...

PBIL Back to PBIL home page