(data stored in ACNUC10043 zone)

EMBL: AP011532.PE47

AP011532.PE47        Location/Qualifiers
FT   CDS             complement(36515..37135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0047"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60119"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ7"
FT                   /protein_id="BAI60119.1"
FT                   /translation="MIFMANKMGAHRKVHIGGTIDRDVAEWLSKTKGGEKFSTHLNNIL
FT                   RDAMESGTPREITSISQFKSTVETLRQRVMSLQDRVESLESGRISRRGRPRKEQIVPEA
FT                   PGPEGYDVHADIDWFISRDKYKKIKPETMERAFGVVAREFDRGEELTVGTFKPGYNVEE
FT                   VGVPYPTFKLFYFPLIRDRMLMKGMIEKVEHAGKKGVYRKRQA"
     MIFMANKMGA HRKVHIGGTI DRDVAEWLSK TKGGEKFSTH LNNILRDAME SGTPREITSI        60
     SQFKSTVETL RQRVMSLQDR VESLESGRIS RRGRPRKEQI VPEAPGPEGY DVHADIDWFI       120
     SRDKYKKIKP ETMERAFGVV AREFDRGEEL TVGTFKPGYN VEEVGVPYPT FKLFYFPLIR       180
     DRMLMKGMIE KVEHAGKKGV YRKRQA                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page