(data stored in ACNUC10043 zone)

EMBL: AP011532.PE471

AP011532.PE471       Location/Qualifiers
FT   CDS             complement(468826..469635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Beta-lactamase-like domain
FT                   (IPR001279)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60543"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS1"
FT                   /protein_id="BAI60543.1"
FT                   /translation="MSEIVFLGTAGGRMVVANQIRKSGGMWLDLDGNAILLDPGPGCLV
FT                   RCVELGLKPSRLDCIVLSHRHIDHSNDVNIMTEAMSGGGFKPKGMLIAPWDCLEGNDPV
FT                   VLKYVRKYIRNNVFALKEGAKYRLNGVSIEGALRLKHSDVESYAIKFRFENKTLGYIAD
FT                   TKYFDGIGEAMKDCDYLIINMVRITYDDRFQHLIPGDVEKVLKVAKPGMAILNHFGMQV
FT                   VKAHPRDIAFRIEKTTGVKTIAAEDGMRLKLDRARAEEDSTLERFIK"
     MSEIVFLGTA GGRMVVANQI RKSGGMWLDL DGNAILLDPG PGCLVRCVEL GLKPSRLDCI        60
     VLSHRHIDHS NDVNIMTEAM SGGGFKPKGM LIAPWDCLEG NDPVVLKYVR KYIRNNVFAL       120
     KEGAKYRLNG VSIEGALRLK HSDVESYAIK FRFENKTLGY IADTKYFDGI GEAMKDCDYL       180
     IINMVRITYD DRFQHLIPGD VEKVLKVAKP GMAILNHFGM QVVKAHPRDI AFRIEKTTGV       240
     KTIAAEDGMR LKLDRARAEE DSTLERFIK                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page