(data stored in ACNUC10043 zone)

EMBL: AP011532.PE474

AP011532.PE474       Location/Qualifiers
FT   CDS             470491..470889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding core domain (IPR011576)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0474"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60546"
FT                   /db_xref="GOA:D1YVS4"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS4"
FT                   /protein_id="BAI60546.1"
FT                   /translation="MVKLTQEVKDSMQGVKTIFLATCSRAGVPNVVPMGAYKVLDDETM
FT                   LLSDQFMQKSLSNMQENPRVALTYWSEKGGFQIKGTVTLHKDDQVFKDDVAWVKGMKPT
FT                   LNPKTAIVMKITDVYVVKPGPDAGKKLL"
     MVKLTQEVKD SMQGVKTIFL ATCSRAGVPN VVPMGAYKVL DDETMLLSDQ FMQKSLSNMQ        60
     ENPRVALTYW SEKGGFQIKG TVTLHKDDQV FKDDVAWVKG MKPTLNPKTA IVMKITDVYV       120
     VKPGPDAGKK LL                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page