(data stored in ACNUC10043 zone)

EMBL: AP011532.PE487

AP011532.PE487       Location/Qualifiers
FT   CDS             483053..484387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains at least two Regulator of chromosome
FT                   condensation, RCC1 repeats (IPR000408)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60559"
FT                   /db_xref="GOA:D1YVT7"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVT7"
FT                   /protein_id="BAI60559.1"
FT                   /translation="MRGFRLILLILICSFSLVLIMPCVTAWSPAVVSIAASNSTSVALL
FT                   DDGTVWQWGYVSDGVEYATPQKVEISVVRKIAAGYGHVLALKGDGTVWAWGSNKYGQLG
FT                   DGTYNDSAGPVQVAGLTGVKAIAAGKDISLALKGDGTVWAWGSNSYGQVGEGSLNYKGT
FT                   AVPIQVKGLNNIQAISAGGSHCLASQGDGAVWAWGDNRHGVLGDGTNESRFTPVRSKIY
FT                   NVMGLDAGDAHALAVMVDGNVWSWGYNYNGQLGMGGTSLNDLGRLSFGPEADSFNPDIV
FT                   RGLSGVKSVAVGASHSVALADNGTVWTWGSNSDGQLGVGKTGGSDMTVPVRVSGINGIT
FT                   AVDAGLYHTLALKDDGSVWAWGSNAEGQVGNRSASAGSPALVLMQTQILPSPTSTPIIV
FT                   TASPTTPESGPNYMLIGSIALLAVIVIVVVTACVLLLRSRKKGSG"
     MRGFRLILLI LICSFSLVLI MPCVTAWSPA VVSIAASNST SVALLDDGTV WQWGYVSDGV        60
     EYATPQKVEI SVVRKIAAGY GHVLALKGDG TVWAWGSNKY GQLGDGTYND SAGPVQVAGL       120
     TGVKAIAAGK DISLALKGDG TVWAWGSNSY GQVGEGSLNY KGTAVPIQVK GLNNIQAISA       180
     GGSHCLASQG DGAVWAWGDN RHGVLGDGTN ESRFTPVRSK IYNVMGLDAG DAHALAVMVD       240
     GNVWSWGYNY NGQLGMGGTS LNDLGRLSFG PEADSFNPDI VRGLSGVKSV AVGASHSVAL       300
     ADNGTVWTWG SNSDGQLGVG KTGGSDMTVP VRVSGINGIT AVDAGLYHTL ALKDDGSVWA       360
     WGSNAEGQVG NRSASAGSPA LVLMQTQILP SPTSTPIIVT ASPTTPESGP NYMLIGSIAL       420
     LAVIVIVVVT ACVLLLRSRK KGSG                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page