(data stored in ACNUC10043 zone)

EMBL: AP011532.PE492

AP011532.PE492       Location/Qualifiers
FT   CDS             complement(488852..489409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0492"
FT                   /product="putative transcriptional regulator"
FT                   /note="Contains an extra Cystathionine-beta-synthase domain
FT                   (IPR000644) in the C-terminal region."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60564"
FT                   /db_xref="GOA:D1YVU2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017158"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVU2"
FT                   /protein_id="BAI60564.1"
FT                   /translation="MELPTPESIKKKRVKLGLTQSELAARAHVSQPLIARIESGDVDPR
FT                   LSTVKSIITALDDMEKSRITAKDLMTAPVISLSPDESVDQAVKIMEKYGFSQVPVLENG
FT                   VPIGSISESALVQAMGSRDIQRISNARVRELMEDSFPAVAPGTDMGTISALLEANHAVL
FT                   VMEMGKVVGVITKYNIMRLLNK"
     MELPTPESIK KKRVKLGLTQ SELAARAHVS QPLIARIESG DVDPRLSTVK SIITALDDME        60
     KSRITAKDLM TAPVISLSPD ESVDQAVKIM EKYGFSQVPV LENGVPIGSI SESALVQAMG       120
     SRDIQRISNA RVRELMEDSF PAVAPGTDMG TISALLEANH AVLVMEMGKV VGVITKYNIM       180
     RLLNK                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page