(data stored in ACNUC10043 zone)

EMBL: AP011532.PE493

AP011532.PE493       Location/Qualifiers
FT   CDS             489565..491103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60565"
FT                   /db_xref="GOA:D1YVU3"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVU3"
FT                   /protein_id="BAI60565.1"
FT                   /translation="MVFAIIQGVRAVKLSGQNAILPATAALLILLYLMPVAAAQSTTGL
FT                   SLSNSSDSDGRAIYVEGYITGGDEVHDKTTYPIPGAIIYFIKDQQVVNQTKSNAIGYYN
FT                   VVITSGTYSVVTAAAGFQTLMDEQEFKGTRTLNRQLKKVPYAGIVPYAVNPVLETSPGR
FT                   EAACTICVENSQLQDQYVSFGLQTPEVDGKNWAGWCPEGQMLGIRSGSQREITFMFQYN
FT                   GDQRGAYVWYVLVTGGSFYAKIPVVVVVKDMPYESLDLYSNYPSRTVKAGDTARFVFSV
FT                   NNGYARDKPLTLEIQKPDGWGATTGNGTLYYAARAEVASSDFWVYVPQDTPPGPYTVNL
FT                   TLKGQDVSSNMLTLYLQVEGTPAYEAVIKGYKASAQGYPSINLTDGDAFDIPVRVYNDG
FT                   EFPIDIMVTAEVGENWAYYMSGAPWDKITVEPGSGSDLIIRSRVPNGTTGNYTAKIYLD
FT                   GGGQTKTLMALLNVTSSESPPIKSDALGGLLLAGGTAGVITVSLLATARKRRRY"
     MVFAIIQGVR AVKLSGQNAI LPATAALLIL LYLMPVAAAQ STTGLSLSNS SDSDGRAIYV        60
     EGYITGGDEV HDKTTYPIPG AIIYFIKDQQ VVNQTKSNAI GYYNVVITSG TYSVVTAAAG       120
     FQTLMDEQEF KGTRTLNRQL KKVPYAGIVP YAVNPVLETS PGREAACTIC VENSQLQDQY       180
     VSFGLQTPEV DGKNWAGWCP EGQMLGIRSG SQREITFMFQ YNGDQRGAYV WYVLVTGGSF       240
     YAKIPVVVVV KDMPYESLDL YSNYPSRTVK AGDTARFVFS VNNGYARDKP LTLEIQKPDG       300
     WGATTGNGTL YYAARAEVAS SDFWVYVPQD TPPGPYTVNL TLKGQDVSSN MLTLYLQVEG       360
     TPAYEAVIKG YKASAQGYPS INLTDGDAFD IPVRVYNDGE FPIDIMVTAE VGENWAYYMS       420
     GAPWDKITVE PGSGSDLIIR SRVPNGTTGN YTAKIYLDGG GQTKTLMALL NVTSSESPPI       480
     KSDALGGLLL AGGTAGVITV SLLATARKRR RY                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page