(data stored in ACNUC10043 zone)

EMBL: AP011532.PE500

AP011532.PE500       Location/Qualifiers
FT   CDS             496101..496364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60572"
FT                   /db_xref="GOA:D1YVV0"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV0"
FT                   /protein_id="BAI60572.1"
FT                   /translation="MDITILYIVAGAACIVISLLVYRSLRAPFFLYLSAALLMACAFII
FT                   TCIVAPEVRALSDLSLALSGASMGAASLQLSYSFGLAGGHRD"
     MDITILYIVA GAACIVISLL VYRSLRAPFF LYLSAALLMA CAFIITCIVA PEVRALSDLS        60
     LALSGASMGA ASLQLSYSFG LAGGHRD                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page